PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn188021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 271aa    MW: 29787.9 Da    PI: 9.7612
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn188021genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.65.2e-1258102147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT+ E++++++a +++  + Wk+I + +g  ++  q++s+ qky
       Achn188021  58 RESWTEPEHDKFLEALQLFDRD-WKKIEAFVG-SKSVIQIRSHAQKY 102
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.97E-1652108IPR009057Homeodomain-like
PROSITE profilePS5129413.64553107IPR017930Myb domain
TIGRFAMsTIGR015576.8E-1856105IPR006447Myb domain, plants
SMARTSM007171.2E-957105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-55798IPR009057Homeodomain-like
PfamPF002496.2E-1058102IPR001005SANT/Myb domain
CDDcd001671.55E-760103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MVSVNPNPPE GFFLDPTGMA LPGLASFSAA AAATTTTTSS SDDLSKKIRK PYTITKSRES  60
WTEPEHDKFL EALQLFDRDW KKIEAFVGSK SVIQIRSHAQ KYFLKVQKSG TNEHLPPPRP  120
KRKAAHPYPQ KASKNAPVLS QLISPVLLEP GFIIRPESST LVAKPVTSAA VSSRTDNSVQ  180
TVNLSHTTKV LPDFAQVYNF IGSVFDPNAS GHLHKLKKMD PIDVETVLLL MRNLSINLTS  240
PNFEEHRRLL SSCEMDAEKD DSSGLNKNPP *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00560DAPTransfer from AT5G52660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015878397.11e-136PREDICTED: protein REVEILLE 6 isoform X1
SwissprotQ8H0W31e-118RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A151T4G01e-132A0A151T4G0_CAJCA; Myb-like protein G
STRINGGLYMA16G29740.11e-130(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9982478
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-100MYB_related family protein